PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI05G26880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 289aa    MW: 30551.3 Da    PI: 6.493
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI05G26880.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.4e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEde+l  +v+ +G g +W + +++ g++R++k+c++rw++yl
  ORUFI05G26880.1 14 RGPWSPEEDEQLRSYVQSHGIGgNWIALPQKAGLNRCGKSCRLRWLNYL 62
                     89******************999************************97 PP

2Myb_DNA-binding37.74.9e-1271111446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       T++Ed ++  + +  G++ W+ Ia++++ gRt++++k++w++
  ORUFI05G26880.1  71 YTEQEDHIICSLYNSIGSR-WSIIASKLP-GRTDNDVKNYWNT 111
                      69*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.942966IPR017930Myb domain
SuperFamilySSF466899.8E-2811109IPR009057Homeodomain-like
SMARTSM007171.2E-111364IPR001005SANT/Myb domain
PfamPF002493.3E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-241569IPR009057Homeodomain-like
CDDcd001672.06E-91662No hitNo description
SMARTSM007173.8E-1067115IPR001005SANT/Myb domain
PROSITE profilePS5129414.2167117IPR017930Myb domain
PfamPF002498.1E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-2270116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGRAPCCDKA SVKRGPWSPE EDEQLRSYVQ SHGIGGNWIA LPQKAGLNRC GKSCRLRWLN  60
YLRPDIKHGG YTEQEDHIIC SLYNSIGSRW SIIASKLPGR TDNDVKNYWN TKLKKKAMGA  120
VQPRAAASAP SQCTSSAMAP ALSPASSSVT SSSGDACFAA AATTTTTMYP PPTTPPQQQF  180
IRFDAPPAAA AAASPTDLAP VPPPATVTAD GDGGWASDAL SLDDVFLGEL TAGEPLFPYA  240
ELFSGFAGAA PDSKATLELS ACYFPNMAEM WAASDHAYAK PQGLCNTLT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1084520.0AK108452.1 Oryza sativa Japonica Group cDNA clone:002-143-C10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637875.10.0PREDICTED: transcription factor RAX2
TrEMBLA0A0E0PQX30.0A0A0E0PQX3_ORYRU; Uncharacterized protein
TrEMBLA2Y7910.0A2Y791_ORYSI; Putative uncharacterized protein
TrEMBLQ6I6340.0Q6I634_ORYSJ; Os05g0553400 protein
STRINGBGIOSGA017601-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os05g48010.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.14e-70myb domain protein 84